PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001709.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 292aa    MW: 32952.5 Da    PI: 5.2023
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001709.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.81.7e-203783248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+WT+eEd +l+d+v+++G g+W++ ar+ g++Rt+k+c++rw++yl
      Pbr001709.1 37 GPWTAEEDSILIDYVNLHGEGRWNSLARHAGLKRTGKSCRLRWLNYL 83
                     89*******************************************97 PP

2Myb_DNA-binding47.34.6e-1589132146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++++++++ +lG++ W++Ia+ ++ gRt++++k++w++
      Pbr001709.1  89 RGNITLQEQLIILQLHSRLGNR-WSKIAESLP-GRTDNEIKNYWRT 132
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.7443187IPR017930Myb domain
SuperFamilySSF466891.02E-3033130IPR009057Homeodomain-like
SMARTSM007177.9E-173585IPR001005SANT/Myb domain
PfamPF002491.8E-183683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-243790IPR009057Homeodomain-like
CDDcd001673.46E-143883No hitNo description
SMARTSM007173.2E-1388136IPR001005SANT/Myb domain
PROSITE profilePS5129418.06988138IPR017930Myb domain
PfamPF002491.1E-1389132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-2291137IPR009057Homeodomain-like
CDDcd001674.68E-1093132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDISNVHDQM KSAGYGSLEA AAAPDQPIEE GLGLRTGPWT AEEDSILIDY VNLHGEGRWN  60
SLARHAGLKR TGKSCRLRWL NYLRPSVRRG NITLQEQLII LQLHSRLGNR WSKIAESLPG  120
RTDNEIKNYW RTRVQKQAKQ LKCDVNSKQF QDAMRYVWIP RLIERIGGLP ESLPDQPRTC  180
TTTTSEFECQ YWVDTNFVPK TSCSTSSDSY DQVQACSIPT DRTSSGDEFM TYPCSGQYGS  240
ENGSGYSQNG INSDIHGFKQ SDYCSTGGDT SVENLWNEEN IWFLQQQLSD D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-283413825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363103.10.0PREDICTED: transcription factor MYB108
TrEMBLM5XUE41e-134M5XUE4_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s19250.11e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.12e-72myb domain protein 2